DPCstruct | MC29
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 109 ± 8 aa |
| Standard deviation of domain lengths | 8.15 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 21.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U8W6H2 | 1-98 | MANLRSERTGLPFVVFISQKDGARHDVRVKVSASAKVRADEMGSYAARPCRHTDGRRLPPHEEKLLEAWIEKNIDVLTRYWDGEIEY… |
| A0A6B2H1U5 | 18-132 | KEFLYEDSWHHNEFLYMDSFSQNETGIENLIVWTGPNPNGFRIKVSNIPNRISSNYFFVMTLPDYQVIGQINEEFITPIIINQIKKW… |
| A0A1T4M0R6 | 7-109 | None |
| A0A066PGX6 | 114-219 | None |
| A0A5M8P0P4 | 72-182 | None |
| A0A1M5KXK6 | 33-155 | None |
| A0A0F9A687 | 62-166 | None |
| A0A539DC33 | 21-126 | None |
| A0A4R0Y6T6 | 394-498 | None |
| A0A255TW74 | 4-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.