DPCstruct | MC28999
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 130 ± 8 aa |
| Standard deviation of domain lengths | 7.92 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183DZE5 | 1-146 | MTSAIDLAELFMTVLEKSKTPASPELLDRFQELFDRLPALLEKDLDTGSGQDRRKQYISLALKWTMAVAEKRSHQRRGHPALHRRIA… |
| A0A7F8R3R5 | 30-152 | NSAADLSMLVLESLEKAEVEVADELLENLAKLFSLMDPNSPERVAFVSRALKWSSGGSGKLGHPRLHQLLALTLWKEQNYCESRYHF… |
| T1JH00 | 770-891 | None |
| A0A218UIF4 | 1-134 | None |
| A0A5E4PNB8 | 136-266 | None |
| U4U1F5 | 487-618 | None |
| A0A2K6N1B5 | 92-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.