DPCstruct | MC28996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 100 ± 11 aa |
| Standard deviation of domain lengths | 11.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 35.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3IGH8 | 21-102 | NAQCPYGGHWVAHGCNTSSQCISYSHVAVSCVDGECCTLASATKCSNGGLAVAHFCKSSEECIPYTSEPVACLSRTCCTIPQ |
| A0A183DXN9 | 1-97 | LASQAWAYFYCPAGGHTVAVGCANAQQCSPYTASPVACINNACCIAKSLPTQPLIQQTPLICYNGGVGLIAGCTTSHQCLPFTTEPV… |
| A0A4U5PDE0 | 6-98 | None |
| A0A0N5AQ21 | 1-95 | None |
| A0A183UFM6 | 231-317 | None |
| A0A0B2VYH6 | 3-108 | None |
| J9DZ86 | 4-112 | None |
| A0A2A6C397 | 94-185 | None |
| A0A0M3JX36 | 14-111 | None |
| A0A183E427 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.