DPCstruct | MC28995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 145 ± 27 aa |
| Standard deviation of domain lengths | 27.27 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 80.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S2N8P6 | 77-237 | WSIFFALLIYYTPSVIQNNEVPMYYYLVMGLVFAVNRVLAQIMVTCMVAFFSRISDIRFGGMYMTLLNTVRSIGWVIPNTSFLKMVD… |
| A0A183DXN3 | 33-167 | AYCFHQVASYSMFVSMMAFNAQVSDPAIGGTYMTLLNTLNNLGGNWPVTLILSLTDHFTFKNCVLKGTKTVLRSCDTKVLSEQCVTE… |
| A0A7S2IWR5 | 4-135 | None |
| U6N7C5 | 5-107 | None |
| A0A7J6RMC0 | 33-185 | None |
| R7Q2E0 | 36-190 | None |
| A0A3Q0IRJ6 | 3-150 | None |
| A0A3P7IU91 | 1-147 | None |
| A0A0C2JW60 | 25-130 | None |
| A0A813JSF2 | 2-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.