DPCstruct | MC28994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 222 ± 54 aa |
| Standard deviation of domain lengths | 53.62 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 71.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10193 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1S018 | 1-146 | MQMPASSSSVASTQAYDSDDDEDFPAYDLPDSERNVELPPADGEEPERTAAAPNYIRDCLEQLSEKEKYEVFEAAFFALDGMIRRKA… |
| A0A183DWP6 | 1-178 | MYITEVLSNWLSLPGELHFEYPPNRSEFIADLERIVDDKDAKEENVEKSFVGKEQESGERRPVALEVEKNIEYDEFPYRHVEAPHYI… |
| A0A7E4RCX4 | 725-995 | None |
| A0A814M947 | 112-347 | None |
| A0A819EHW9 | 741-964 | None |
| A0A2G9RSV9 | 64-250 | None |
| A0A0D8XII5 | 1-206 | None |
| A0A090LBE3 | 388-556 | None |
| A0A0X3NKD9 | 370-631 | None |
| A0A0G2HG71 | 4-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.