DPCstruct | MC28993
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 85 ± 5 aa |
| Standard deviation of domain lengths | 4.63 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 79.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 61.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0066 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4PUI8 | 5-80 | GVFTNVIPLLLLLKICLIETIRASRAEYVTCGTILKLMNTELKLRLHSHDIKYGSGSGQQSVTAVEITDDHNSHWA |
| A0A183DWN9 | 28-109 | GMLLLLLSVLVASAFCVLGTCAASREADEFVTCTSVVKLKNNQDGVRLHSHDVKYGSGSGQQSVTAVQDGDDVNSYWQILAD |
| A0A0Q3SSZ4 | 182-264 | None |
| A0A2N9GH29 | 1-83 | None |
| A0A2U1MTN3 | 214-293 | None |
| A0A6P6SBM4 | 1-81 | None |
| A0A7J6EPU0 | 1-87 | None |
| A0A0D2PRP8 | 2-91 | None |
| A0A822ZGF3 | 1-82 | None |
| A0A7J9A7S3 | 63-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.