DPCstruct | MC28990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 65 ± 5 aa |
| Standard deviation of domain lengths | 5.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 52.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183DTB3 | 1-61 | MYVRAMISQKLGINQLPMSVAFFSQVDIDRVLRKEVDLACKTPGGEGIPPGEALDMNAILE |
| A0A7J8BLW8 | 591-655 | RCLFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCETPSNPTGMERRYGIPQGEALDIYQILE |
| U4UQB4 | 325-393 | None |
| A0A4Y9XPJ9 | 201-265 | None |
| A0A2G9S158 | 4-70 | None |
| A0A0B1TFI9 | 26-96 | None |
| A0A6J1WF44 | 44-111 | None |
| A0A183HB19 | 44-106 | None |
| A0A3P7J365 | 38-100 | None |
| A0A402FFH6 | 199-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.