DPCstruct | MC28989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 106 ± 9 aa |
| Standard deviation of domain lengths | 8.77 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05183 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183DR59 | 1-128 | MNIALKHSKAVDFPKTGIPPDPLTRTWTKDENEKVIPPERACRWPDFMCKNHEPSYVSPRLVGQLFRRVHLLVDVFNHVGAVEDASP… |
| A0A4V5ZXV0 | 136-252 | SIARKHSLAVDFPKTGKPPEKLTQTPKNGMPPEQPDRFPDFMERSTSPAYVSSSLNGQLYRRAKEMDSVLSQITDRQQTAAILLDPE… |
| B7Q2B5 | 97-202 | None |
| A0A6A6M138 | 159-257 | None |
| A0A445MFI0 | 10-111 | None |
| A0A0A9F2B6 | 58-150 | None |
| A0A4Y2IZ74 | 1-115 | None |
| A0A6P3Z5L6 | 44-150 | None |
| A0A6S7FT68 | 69-167 | None |
| A0A2K3KUA6 | 2-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.