DPCstruct | MC28988
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 170 ± 27 aa |
| Standard deviation of domain lengths | 27.42 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 18.64 |
| Pfam Score | 98.33 |
| Assigned Pfam label(s) | CL0322- PF02932 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K8UQG2 | 316-462 | DGVNTLLSKLFLNWGHFCAKHPVLVLAICSWIIGGLAYGTTHLSVTTNPIELWAGKESQTRLEKEYFDEHFGPFYRTNQIFIKPLNQ… |
| A0A183DQ82 | 5-149 | NDVLICTGYRHPLAFIMVPFFITCLLGTGIILKFKIVRGVHYLYTPLDAQWKLENRVFQEFWASQDDLYYPGKDVFRRKSVFLLIEA… |
| A0A0N4W6L6 | 6-143 | None |
| A0A5F5Y1U1 | 818-982 | None |
| A0A0N5DBL4 | 49-252 | None |
| A0A5B7DUZ7 | 92-251 | None |
| A0A0R3QDX4 | 14-152 | None |
| A0A183H7U9 | 294-464 | None |
| A0A3P6QP55 | 129-298 | None |
| A0A2G5UFK3 | 92-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.