DPCstruct | MC28987
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 146 ± 16 aa |
| Standard deviation of domain lengths | 15.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 31.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0465 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z1IQY5 | 1-115 | MRAALETGADPHALDEAPRPERSTGRPLHYATDVTHFDLVPRYENLPVLEFLLEYGADPQMEGKGGASESPLEDVERIVKNNYPKLR… |
| A0A6A6AS15 | 1-174 | MDRVFEERPPLLWEPISTEPIEVRLANMRAAIASGADPNELDGTRKPRVGRPLDYAITTLACAYHETVKTNLPIVELLLETGADPRL… |
| A0A6A5UDN1 | 36-188 | None |
| A0A3M9YJI3 | 336-493 | None |
| A0A1L7WS40 | 308-453 | None |
| A0A0G4MIG0 | 1-158 | None |
| A0A0G2F771 | 44-196 | None |
| A0A4Q4WUQ8 | 31-167 | None |
| A0A6A6WPR6 | 9-154 | None |
| M7SDD8 | 16-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.