DPCstruct | MC28985
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 101 ± 7 aa |
| Standard deviation of domain lengths | 7.27 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 38.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E1A2W0 | 8-104 | GRSLLVNVLNLAVETWETGTDKTKADLAQESGQWGTHLEKIRTWRTRSLDKYLPQKPHWRKAVQTARHVLRHTPEGRPLRTSLTERL… |
| A0A090SB38 | 3-91 | SSLSYWEEVTGQSKFAFAEQSGLWRVYLDRSTLQTRTLDKYLRLETLPKTPRWRTVLSSVEYILEHCHKQGPERDYIISLRDKLQRL… |
| A0A7W0IVP2 | 488-586 | None |
| A0A7X7E3L2 | 74-170 | None |
| A0A850R0C4 | 199-299 | None |
| A0A1G0J777 | 1056-1165 | None |
| A0A2D4TKQ5 | 26-126 | None |
| A0A7G1L8K2 | 256-351 | None |
| A0A3M1UKZ2 | 835-951 | None |
| R8ATH1 | 1052-1150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.