DPCstruct | MC28982
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1799 |
|---|---|
| Mean domain length (aa) | 139 ± 25 aa |
| Standard deviation of domain lengths | 24.53 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 12.47 |
| Pfam Score | 95.85 |
| Assigned Pfam label(s) | PF04279- PF12119- PF08354- CL0314- PF02770 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447MVR5 | 8-76 | WPIRVYYEDTDAGGVVYHASYVAFYERARTEMLRHHHFSQQVLLAERVAFVVRKMTLEYYAPARLDRYA |
| A0A3M1J630 | 22-155 | PFQPPYRFVDDITFFDEDRLQAHYTFKETEFFYPGHFPQRAVTPGAILGEAASQAVLALGIYLMRHEAAAEERMIFLTSHELRFKRA… |
| A0A162MRK4 | 1012-1158 | None |
| A0A4R4DTB7 | 295-441 | None |
| A0A0D2PA65 | 40-171 | None |
| A0A151HAI1 | 150-321 | None |
| A0A6G0XWF1 | 1-121 | None |
| A0A349MIC3 | 9-143 | None |
| A0A820B7G4 | 1-130 | None |
| M1FE61 | 6-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.