DPCstruct | MC2898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 177 ± 12 aa |
| Standard deviation of domain lengths | 12.20 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5QQL2 | 6-167 | NIALNQWESDTEIRGFFERQTVLFSDLALDHVNTGLVDHESLLVPGLVAAGTAVQSYLFHADSVAGFDALLSGYVVFDQPILGVLIH… |
| A0A2A5CLB2 | 11-196 | MVCMFTSVVANATLIGFSGCVGANSCDVTITPPNPVLPNPNDGVLLGWDEVQNLTLTESLRVDRVFDESASFISDAGSGDFFIAAGT… |
| A0A7X2D523 | 215-393 | None |
| A0A1I1JWB3 | 27-201 | None |
| A0YYB1 | 3-194 | None |
| A0A5C6AC31 | 5-167 | None |
| A0A520Y1B7 | 246-412 | None |
| A0A7C2XJQ4 | 207-381 | None |
| A0A538QH67 | 1-167 | None |
| A0A4P9VN03 | 1-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.