DPCstruct | MC28976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 140 ± 16 aa |
| Standard deviation of domain lengths | 15.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B8HL12 | 1-121 | MATIPTQNAVPSEAPRDLKFNSGKIDEFVTSKAREYFDRFGKSHLTIEGMKWMVEQVIETFKVDMNQAIIAAGYIPMDSFRKGAEIT… |
| A0A1S1HK21 | 6-155 | TKDPLGSASVKNLYDNSENLDKATNDRESETWTDRLGKERISWHGMEMQNARLIEQLNTKMDAAITAAGYLPVGNFQLGAEILQINQ… |
| I0QRN4 | 140-250 | None |
| A0A377CEJ6 | 1-99 | None |
| A0A2S3WQ20 | 6-140 | None |
| X6QAZ0 | 4-145 | None |
| A0A7H4SJT8 | 43-167 | None |
| A0A7H4SGF6 | 1-140 | None |
| A0A7H4MP62 | 13-140 | None |
| A0A087KTX0 | 1-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.