DPCstruct | MC28973
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 227 ± 32 aa |
| Standard deviation of domain lengths | 32.39 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B3S996 | 9-274 | LIVLQWMWILMQVDCLNETPLHDPTKDARKCLSQCRLSIEDEEATRKTFKAKVSVDTVRVLYFNFLNSTKQPIYSFFHGDNKYAWVK… |
| A0A6J8DKM0 | 3-210 | VYLLTLWNITILLLLFLTVDSMKIKECSLMFQQSKQSHKSLLKTARLLTITVELENSTNLPECVVKNSDLIQPLQWKRISGTHGKGL… |
| R7TC74 | 40-276 | None |
| A0A8B6HPK5 | 70-270 | None |
| A0A8B6H6L4 | 270-459 | None |
| T1FG56 | 111-341 | None |
| A0A7D9L7Z0 | 1-218 | None |
| A0A6S7I388 | 1-160 | None |
| A0A6S7I0U3 | 27-303 | None |
| A0A3S0ZUD8 | 69-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.