DPCstruct | MC28972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 426 ± 53 aa |
| Standard deviation of domain lengths | 53.22 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 23.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0561 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226PK89 | 1-306 | MAAGRGDALSQEELRKRLYQTFKDRGVLDALKTQLRKQLIHELMHPILSGELQPQTVPSDDSLLLITASNSLVADHLQRCGYEYSLS… |
| B3S7A9 | 1-349 | MVDLEEPTLSEEELKLKLFHNFRQRGILTTLKSQLRKKMVDELQQRQGVLTSNINHCEQTVNQLNLDVGNSIICNHLKTYRYDYALS… |
| G3NIP7 | 2-440 | None |
| B5YMV6 | 1-482 | None |
| R1EQP9 | 7-458 | None |
| A0A2R6XKX6 | 1-489 | None |
| H3HD51 | 2-374 | None |
| F6XFW5 | 201-664 | None |
| D8TTK1 | 4-454 | None |
| A0A6P7XQ16 | 1-431 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.