DPCstruct | MC2897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 61 ± 4 aa |
| Standard deviation of domain lengths | 4.44 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 76.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00124 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8A5RCG2 | 155-212 | MAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAIEAPT |
| A0A822LEY8 | 80-147 | MAFNLNGFNFNQSILDSQGRVIGTWADVLNRAGIGMEVMHERNAHNFPLDLASGEQAPVALTAPAING |
| A0A5N6LQ12 | 18-81 | None |
| A0A6F8SPI6 | 218-276 | None |
| A0A218QVA2 | 1-64 | None |
| A0A1Z9JCR4 | 36-98 | None |
| A0A856MBW7 | 1-54 | None |
| A0A2G3B260 | 463-520 | None |
| A0A7T7DKA2 | 1-48 | None |
| A0A835IZ33 | 222-281 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.