DPCstruct | MC28968
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 166 ± 33 aa |
| Standard deviation of domain lengths | 33.01 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.86 |
| Pfam Score | 91.76 |
| Assigned Pfam label(s) | CL0286- CL0279 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q4P525 | 281-441 | MRTPEQAGAYVRKLQQLVRRIGASDGNMQEGSLRCDVNVSVNRIGEPFGTRCEVKNLNSVRFMMNAISFESHRQVKLLQQNGRVEQE… |
| B3RXE0 | 188-339 | VLRSINTCTGNFDEGAIRVDANVSINRSGDPFGTRTEIKNISGLRLLGKAIDNEIERQINHVESGGKIVHETRGYDEKLGLTLRMRD… |
| A0A670J519 | 244-373 | None |
| J8TSK7 | 72-249 | None |
| A0A837Q2U1 | 6-107 | None |
| K2S685 | 2-162 | None |
| A0A4Y7L8Y3 | 232-397 | None |
| A0A0G0V2N4 | 158-322 | None |
| A0A044V152 | 124-283 | None |
| L9JJ92 | 242-399 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.