DPCstruct | MC28966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 148 ± 31 aa |
| Standard deviation of domain lengths | 30.61 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.22 |
| Pfam Score | 97.23 |
| Assigned Pfam label(s) | PF07670- PF07662 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177G680 | 2-110 | FSPIAWLLGVPAGECTIVGSVLGLKLVINEFVAYLHLGPSLQNGALSARSGAIATFALCGFANLSSIGILVAAFGSQCPERRAELAH… |
| B3RUU1 | 400-545 | IIAFLSALKFLNAVLGWLGAMVNYPQLSFEIICSYVFMPFAFMMGVEWKDAHRVAELIGMKTFLNEFIAYDALSKLIKNRLQCEGPY… |
| A0A821G229 | 27-202 | None |
| A0A7V2V0C0 | 260-414 | None |
| A0A356KSR7 | 428-541 | None |
| A0A2T4C0F9 | 40-159 | None |
| A0A7C1SPX7 | 263-405 | None |
| A0A7R9A576 | 12-140 | None |
| A0A7R8XFD5 | 31-233 | None |
| A0A2R7RUS9 | 15-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.