DPCstruct | MC28965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 287 ± 67 aa |
| Standard deviation of domain lengths | 67.46 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 68.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12767 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J3LP65 | 1-319 | RVELEGLYGQLKAALGEAWGDYKIALGQFALGSLSQAELSWVLQPLLCPPAAAGAPAAETAKTTTSPLHLHNAFLIALYANSMRDPP… |
| B3RPC9 | 18-289 | KKQLTESLGDSESEYWSNLKQWFKGMIKKSEFDMKARELLGARCDSKVSLPRQRSSSQNEVRTECPKEEISDTESFDQDTFVSTNHF… |
| A0A2H5SAV5 | 6-247 | None |
| F1L5R6 | 2-257 | None |
| A0A146I1R7 | 2-303 | None |
| A0A4S8M9R2 | 1-287 | None |
| A0A066VTN7 | 16-337 | None |
| A0A1Y1VM13 | 31-304 | None |
| A0A5P1EYM8 | 69-287 | None |
| A0A397UYL3 | 41-375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.