DPCstruct | MC28961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 110 ± 10 aa |
| Standard deviation of domain lengths | 9.73 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B1BI66 | 16-108 | ESTPTKTRFSNSVNTYQKLSINFIPEDPLQFKKLLLKEKKAWVLLHMTDGTKHLHEWNALRFTEHSDVLGNLRSGYLRNWRDKGIIN… |
| A0A8A5DQ89 | 29-120 | IERLLDLVEESGSKSSESKPSLTFVPDEAAFKNELIARKKAQVVLHLKNGERDVIHWNASRFQPSSNLRANLWSGILRNWKDKGIIS… |
| A0A4Q0IIH9 | 204-323 | None |
| A0A840R509 | 2-128 | None |
| A0A7Y4AF73 | 24-123 | None |
| A0A6N9CRF5 | 146-259 | None |
| A0A7W4CGS4 | 1-117 | None |
| R6U8I6 | 322-425 | None |
| A0A3N2KRM4 | 260-378 | None |
| A0A0U4UZS5 | 91-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.