DPCstruct | MC28957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 102 ± 14 aa |
| Standard deviation of domain lengths | 14.44 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 34.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A218QV95 | 2-91 | LPESLVKAILESMALADPQADVQLALKCPACAHHWQATFDIVSFFWSEIHGWAGRVLREVHTLASAYGWREADILAMSSQRRRLYLE… |
| A0A3A8PHU3 | 6-104 | QPLTPDGWKALPVRSRHAVALALAEGTTAPDLGLLGRCPQCSAWLELELDPFALLARELRGGAARLESEVHCLAFHYHWSEADILAL… |
| A0A4U1IPB1 | 85-180 | None |
| A0A1P8WUI8 | 120-224 | None |
| A0A2M9JRB1 | 27-135 | None |
| S4MEW6 | 25-127 | None |
| A0A1N7NUJ2 | 125-217 | None |
| A0A080LV56 | 37-162 | None |
| A0A838YPY8 | 27-154 | None |
| A0A7X5VT65 | 120-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.