DPCstruct | MC28955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 95 ± 12 aa |
| Standard deviation of domain lengths | 12.37 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B3NGE5 | 15-92 | WRRKKPSPVTIIHVNQQTIRQNQKREKPAPVISVKQGQNNTYGHEVEIHGPCRVVYRRDKPKPYGARVWIETLFGVEV |
| A0A351GGJ6 | 2-74 | SKKYIHVNQHKIKSNIKNGTAEPVITIKEGKSNTYCSEVLIEGPSTVRYGENGDKILSCGARVVIETEADIEI |
| A0A6P0RHB6 | 37-139 | None |
| A0A6M0GFI8 | 53-155 | None |
| A0A0D8ZP85 | 1-78 | None |
| A0A845USP4 | 49-144 | None |
| A0A846E0D8 | 28-122 | None |
| A0A6P0MUE8 | 124-237 | None |
| A0A845ZBN1 | 1-104 | None |
| A0A6L9ZMU6 | 41-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.