DPCstruct | MC2895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 153 ± 19 aa |
| Standard deviation of domain lengths | 19.47 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14218 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822L7G7 | 1-150 | MKHRQPCQILAMLFLTGAATFSVPEPSKSAGKGLFFCGQLQGKWNTFVKRPKRNIAIIEWTSNDFAESGWDNRKRCITVSDRFNQYA… |
| A0A2L2MZL9 | 1-138 | MKLASLTNVLVAGGIALSATATINQPSQAESRRGFYCDTLGNKPVTVYTNPRGVSEPWIRWTSNYFRDAGYNKLTRCQDVSHRLENY… |
| A0A845VWS4 | 59-214 | None |
| A0A846DD35 | 72-238 | None |
| A0A251WAG8 | 1-161 | None |
| I4FMD9 | 1-109 | None |
| A0A0P4UPK4 | 1-170 | None |
| A0A1X9L8Z5 | 24-191 | None |
| U5DJS2 | 3-166 | None |
| A0A7C3ZHU1 | 562-680 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.