DPCstruct | MC28949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 6.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 48.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832JYP7 | 182-249 | ALILLGGVYVLEALSVILQVASFRLTGKRIFKMSPLHHHFELGGWPETGVVLFFWLLAFICVGAGLYI |
| A0A7W0L767 | 2-66 | VVVAMSVTIQILVFRLGGGRRIFRMAPIHHHFELAGWTENTVVVRFWIVTGMAVAFGLGLFYADW |
| A0A6N9Y5A7 | 30-95 | None |
| A0A7V0Y030 | 9-80 | None |
| X8F4Z1 | 1-54 | None |
| A0A4Q3I6T6 | 716-782 | None |
| A0A654TL94 | 36-107 | None |
| T0PN54 | 137-203 | None |
| A0A831XN54 | 88-162 | None |
| A0A6J7GE20 | 132-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.