DPCstruct | MC28948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 161 ± 26 aa |
| Standard deviation of domain lengths | 25.51 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.83 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 25.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09557 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0L513 | 43-213 | GGGGQQTTTSMDQDVPMDRDSTMDRDRTDEAGIVGRDTSGPTTDDAMTRSEERLNVGTESVQTGRARLRKYITTETQSVQVPVSREE… |
| A0A317DJG3 | 2-121 | PGAPEVVRSEERLRVGTESEPAGTARLRKHVVTENVQTAVPVEHDEVSVVREPITAANRGDVRPDIGDEQREMELRAEHPVAAKDQV… |
| D7GL54 | 13-196 | None |
| A0A2W5YLS3 | 24-196 | None |
| A0A2W5YIX3 | 3-157 | None |
| A0A2W5YIU5 | 2-184 | None |
| G8SIZ9 | 44-168 | None |
| J7IXB3 | 64-206 | None |
| A0A1S8LD35 | 2-123 | None |
| A0A2S2CTW8 | 41-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.