DPCstruct | MC28945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 660 ± 134 aa |
| Standard deviation of domain lengths | 133.68 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 81.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q9D6Q9 | 203-1084 | AYARLGFNEQGLHVINGESMLTLDGKLYAVEKPLDSRYYRIKHPSRPDAFKPDVRHNGTGAWHTELEYPQQWDRSTLLERLGHTAQA… |
| A0A2S8HP80 | 567-1249 | ADTISRFKIDQDLGAAGTPEQFNSRYAALQQSEHEWVRLFQQQYPTLPKGAIEQIFDRYGVDIRQAPDVTEFRQVFTRLDSKARQYQ… |
| A0A5E7C6P0 | 183-869 | None |
| A0A7K4EBT9 | 316-1030 | None |
| A0A2R7R5E0 | 23-586 | None |
| A0A3M3NZ68 | 73-913 | None |
| A0A3M5W4X2 | 6-402 | None |
| A0A560RUK5 | 82-822 | None |
| A0A1B5F8Z0 | 94-778 | None |
| A0A6I6V6B0 | 1-455 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.