DPCstruct | MC28943
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 186 ± 15 aa |
| Standard deviation of domain lengths | 14.60 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428SNG1 | 17-200 | AFAETLPSLSCAAGSEVTAHPACDSFLSSNDDCATVLDRPGKEDCLCNQEYLDSLFGCENELRLCYRREDLGVNFDRARQLWNSLCG… |
| A0A2V1D564 | 23-210 | TAVPQASCLNAAARTATGYGKCESMMSEVMRCDASVSTNKPAAASCFCRQEILNSILECQNESNFCSGMNNGYLWANTVKYWHEKCD… |
| A0A428UDJ3 | 14-201 | None |
| H1VZR5 | 11-205 | None |
| A0A4Q4X7H3 | 10-161 | None |
| S8BK15 | 29-216 | None |
| A0A0D2BZ11 | 7-204 | None |
| A0A6A6IQV2 | 1-206 | None |
| A0A1C1CK78 | 3-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.