DPCstruct | MC28941
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 132 ± 12 aa |
| Standard deviation of domain lengths | 12.02 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A395MC32 | 16-134 | TGTQAWQVTAYNNVANCKANKGSTYRIISGATNNEACITFGGSMPNTSCREYRNGGSSNGDCSGGFDVRSMIQEAGNCIVFDQTNCN… |
| A0A7C8N4P1 | 432-581 | SSTSPTSSSPISTTSAAVTPTATWELTAYDVDCDGQESSSDFSYYTLQGYSEQSPDEQCSNIQSGLPINSPTSDSCAWFTNGGFNGP… |
| A0A1Y2A1A6 | 1-133 | None |
| A0A2L2TP21 | 131-254 | None |
| A0A2S7P802 | 274-392 | None |
| A0A2L2SYU6 | 13-143 | None |
| A0A2T4B7I1 | 103-239 | None |
| A0A2H2ZKI7 | 287-434 | None |
| A0A1V6P5Y9 | 150-287 | None |
| A0A1B8ELT4 | 236-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.