DPCstruct | MC2894
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 370 ± 84 aa |
| Standard deviation of domain lengths | 84.43 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 77.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20248 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J4YDX8 | 235-600 | SGPHAGDFVLTLGGYHPEFVRPLHYPDVPRLRASWQVTDEVTLTADMYFALTPSCLMAGGKLSVIYQTSCIKAWYVAYANFLLSWKP… |
| A0A822L4T4 | 3-334 | GGHLQATWNSGPLSAWFNAGADFLMSWKPYHYDISIYIDMGVSYTFQFFGTQHITVQLGADLHIWGPEFTGIAHIHLWIISFDVSFG… |
| A0A6F8XPJ6 | 11-285 | None |
| W9JPA2 | 86-510 | None |
| A0A0M2UVB2 | 564-897 | None |
| H5WRH5 | 803-1116 | None |
| A0A5C6SYW5 | 3-373 | None |
| A0A369JME3 | 722-1152 | None |
| A0A1E7N723 | 530-939 | None |
| A0A1V3ZY80 | 413-842 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.