DPCstruct | MC28936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 99 |
|---|---|
| Mean domain length (aa) | 143 ± 22 aa |
| Standard deviation of domain lengths | 22.16 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09350 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I1XC67 | 21-136 | DTGWYYEDHLTAIVKRAEKEGAFDNLKGKGKPLVFEDNDLTYNPEKQLNKILKENNILPNWVKLGKEIEQLKEEVKTYTVEYNIKRT… |
| A0A4R4SPM4 | 4-133 | RWEAAAEAQIRAAQERGEFDNLPGMGRPIPGRGVPYDESWWIRSYLEREKLPSELLLPTPLLLRRRIERIPDEVRDLPTEASVRAYV… |
| A0A399YDT9 | 41-187 | None |
| A0A1B1ZYQ1 | 5-141 | None |
| A0A838RHY3 | 3-160 | None |
| I4Y754 | 21-210 | None |
| A0A536ZS79 | 1-118 | None |
| A0A077WAT9 | 162-316 | None |
| B9S0B6 | 4-120 | None |
| A0A5C8NRK4 | 35-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.