DPCstruct | MC28932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 130 ± 14 aa |
| Standard deviation of domain lengths | 13.73 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A225E0T1 | 55-173 | GFITFHPRYERFLRRVGVSSPAAALALRGEVVCGHPDRHVARVELRSGDARRVVYVKREHVIGLRTRVKNRFAGFGPVARSEREAMT… |
| A0A7V0JQF0 | 4-148 | MQVNLRYSDPLSDLGLDNFDSVWNLRGLKTVKQLRDRSVEYYDFFYRGKNRRFYPKRHIQESLSPVKIPLGGLRGADRDPQGILEFE… |
| A0A2X2YRZ0 | 3-131 | None |
| A0A4U1M2Z8 | 192-330 | None |
| A0A0S7XUS9 | 360-486 | None |
| A0A6C2YLL6 | 2-134 | None |
| A0A7C3XN30 | 269-420 | None |
| A0A2N6DSP4 | 75-194 | None |
| A0A5C5XX31 | 16-140 | None |
| A0A661QF58 | 103-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.