DPCstruct | MC28929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 118 ± 12 aa |
| Standard deviation of domain lengths | 11.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J3M2F6 | 88-200 | VNEILAGLPMKVVVSAGKGSVVVSYNRDEICIENCSSPEVCPVTKIKRPCAMFELIKFACNEAKVLVSHQLAPGIGAIKGEEFLALL… |
| A0A7C8EEZ6 | 1-119 | GEVDSKLPNPIRVPSGTLYASFATFLCPDYCSEPEEICTHTGKERPGNLYEVFGGVLASGFDVAVLRSWQLAPGVGGYPGRSLRQLL… |
| A0A0F8QQK4 | 1-141 | None |
| A0A0E3NMP1 | 1-122 | None |
| A0A3N5IRD8 | 10-107 | None |
| A0A2H0AHQ1 | 18-147 | None |
| A0A2V7R5C9 | 28-148 | None |
| A0A7V4KNM7 | 128-242 | None |
| A0A832CSJ4 | 109-231 | None |
| A0A7K3Z4H7 | 2-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.