DPCstruct | MC28928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 141 ± 20 aa |
| Standard deviation of domain lengths | 20.34 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0635 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A524PAS9 | 3-134 | GRVKGFRFAGVHSGVKAGDALDLGLVLADEPAAATGVFTKNRVRAAPVVISERRLQSGLAQAIMVNSGNANACTGKQGRLAALALTR… |
| A0A7C8E8X5 | 1-133 | MTPVPAEAAKNTKNVTVSRGPFEVAGFLAGAVESGMRYSGRLDLALICAQDPAGCAASGVFTRNFFCAAPVELCRERLEKHRARAIL… |
| A0A356KU95 | 1-133 | None |
| A0A855HWY5 | 2-146 | None |
| A0A366SBH0 | 420-555 | None |
| I7LRE0 | 1-114 | None |
| A0A3C1WIL8 | 8-130 | None |
| A0A358GXA9 | 2-142 | None |
| A0A6N6Q2L3 | 18-153 | None |
| A0A6I7QN14 | 21-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.