DPCstruct | MC28926
Metacluster Properties and Pfam Annotations
| Number of structural domains | 74 |
|---|---|
| Mean domain length (aa) | 157 ± 25 aa |
| Standard deviation of domain lengths | 25.25 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 21.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4YTC7 | 5-158 | TVKEINADPGCSGRTTAIYSTITEDTCSGGVTCTTESGWTDTTSSEYKLCNYDRAGYLRYAFPNVQYLLFDYYEDNECKTLVQSNAI… |
| A0A6A3JYN2 | 847-989 | RGPSLMKAAVLYDTKDCGSVPVELTAHPVRRSCLSSTTSTCQKVDWSYTLYQASDCVDDVAEFAASKFGSAPYLIVENYAADTNCQT… |
| A0A6A3SRL5 | 9-139 | None |
| C4MAD9 | 10-238 | None |
| A0A6A3U404 | 2-130 | None |
| A0A6A3T3I2 | 13-173 | None |
| A0A6A3T259 | 216-402 | None |
| A0A2P4YQV2 | 76-244 | None |
| G5A0F1 | 24-182 | None |
| A0A6A4C0K1 | 471-610 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.