DPCstruct | MC28924
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 281 ± 60 aa |
| Standard deviation of domain lengths | 60.46 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 73.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 26.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20245 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y1Y3Y6 | 167-388 | IFYANLQNYGSWFQTTDYGYAWQPAVVRTDPQWRPYTRGHWLHSDQGWTWASDEPFGWAAYHYGRWALLEGVGWVWIPGEQWAPAWV… |
| A0A1M3CGZ8 | 1-303 | MKPSLLLAALVALLGFFASPAPAQTQSPVTFDTFFQELSPYGEWINVQDYGMSWRPKVDPGWRPYTDGRWAQTDAGWTWMSNEPWGW… |
| A0A522APP1 | 13-319 | None |
| A0A537N684 | 231-533 | None |
| A0A3N5G1T1 | 73-378 | None |
| A0A832BLI7 | 20-232 | None |
| A0A526YQC8 | 1-258 | None |
| A0A3D3CQL4 | 18-344 | None |
| A0A535ACH3 | 1-177 | None |
| A0A353BHE9 | 80-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.