DPCstruct | MC2892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 78 ± 8 aa |
| Standard deviation of domain lengths | 7.76 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 46.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A651HTR5 | 223-300 | SRMRRFAVERLRREQDRDLNGFRVHFDEYYLESSLYDDGRVDETVQRLRKTGLVFEQDGAVWLRTSEFGDQKDRVMIK |
| A0A6N6XP02 | 30-103 | YRVFHQAALHAILDDIKDDLADFGVTFNQWFSEASLSAKIDEALETLDQRGFLYEKDGNIWFKSTEFGDEKDRV |
| A0A398CIN7 | 1-86 | None |
| A0A0B0HP78 | 63-147 | None |
| X1X198 | 254-338 | None |
| A0A3A0HRG4 | 57-142 | None |
| A0A7C7GW65 | 231-306 | None |
| A0A3T1DWY0 | 245-306 | None |
| A0A645B994 | 2-69 | None |
| A0A176RUZ4 | 85-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.