DPCstruct | MC28917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1056 |
|---|---|
| Mean domain length (aa) | 135 ± 27 aa |
| Standard deviation of domain lengths | 27.48 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 86.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 17.63 |
| Pfam Score | 98.36 |
| Assigned Pfam label(s) | CL0023- CL0063- CL0268- CL0109- PF03477 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661AN74 | 2-75 | AHAPYSGYRVGACLITQDGKEYFGFNIENASYSLTICAERVAFVHALLNGERNFKRIYVTDFPCGACLQFMAEF |
| A0A2W4T408 | 4-144 | WEARFFQLCALVASWSDDRSRQVGAVIVDTENNVLSIGYNGFPRRVDSVRSHRHSREGGEKYLWIEHAERNAIYSAVRSGASTRGAR… |
| A0A2K6U5H2 | 7-140 | None |
| A0A7T8XQM2 | 7-142 | None |
| A0A1I8IPT0 | 21-181 | None |
| A0A0K0E2M9 | 153-281 | None |
| A0A377CC48 | 42-135 | None |
| R7CJ22 | 62-195 | None |
| A0A835H5D3 | 162-323 | None |
| A0A7S1UQ75 | 9-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.