DPCstruct | MC28911
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 170 ± 36 aa |
| Standard deviation of domain lengths | 36.10 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.97 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | PF10197- PF11708 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G0QYY4 | 1-173 | MRENPNPNDLNSIFKGENSLRTTGDAVKLINQEKFAWDQVEKNGLSLSSIANPTLTEKVFKEMLDKDKNIKNMKIKQILQVYGGEEH… |
| A0A1I8A9K1 | 1-166 | MRENPFAGVPGREKEAAKFAGENFVRYTGEVQQANEAQVFAWSARCQGVDVHALAEPTKLEQYKKDFEEQKEKSKKEHMEKLIEKYG… |
| A0A2A2KP27 | 140-340 | None |
| A0A0M3IPF8 | 8-177 | None |
| A0A2G3CV79 | 114-332 | None |
| A0A0N5CKM1 | 5-174 | None |
| A0A1Q3D4Q0 | 1-108 | None |
| A0A822XSV7 | 121-234 | None |
| A0A1A9X781 | 119-242 | None |
| A0A7S1QWA8 | 255-435 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.