DPCstruct | MC2891
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 102 ± 8 aa |
| Standard deviation of domain lengths | 8.25 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 48.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0099 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V3YK71 | 145-240 | HLAKGFEGQLTATLHMDKDDAADARKLLPVLERKAGRVLANGFPTGVEVVDSMVHGGPYPASTNFGATSVGTMSIRRFLRPVSYQNI… |
| A0A251XE67 | 1-99 | MHLGADEAEAGGAATADLIRVLAARAGRVLVDAWPTGVSVTDAQQHGGPWPATTLDRGTSVGTASLDRLLRGVAFQGVPDALLPEPL… |
| A0A0K2R7H6 | 143-249 | None |
| A0A231MV97 | 19-129 | None |
| A0A7K3GIS0 | 63-174 | None |
| A0A7Y4TJ55 | 19-129 | None |
| A0A0Q8JJL6 | 1-75 | None |
| A0A6J6Z909 | 2-112 | None |
| D9WZS5 | 307-418 | None |
| A0A6L5R381 | 725-826 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.