DPCstruct | MC28909
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 221 ± 33 aa |
| Standard deviation of domain lengths | 33.48 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 21.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8A857 | 24-210 | QLDDDELQLDEEERIEDYKKKLQIINKKIENGKNCLMFAYEVQRCLPAAVRGIFTGQLNEIRESLRFISECRKFEVRESSAAVKDAL… |
| A0A2R7WNV9 | 135-340 | EQQKTVLTYLEDTIAFALLISDASKEIERPLFGQSTMEAAEAVEFFTTAYKFNAGDSRRVVRQMIVLIWSKVPGIKEAISAAYKTLY… |
| A0A7R9KIM2 | 178-439 | None |
| A0A0C9VI60 | 585-808 | None |
| A0A814MTZ8 | 168-441 | None |
| A0A2P8YWI7 | 494-765 | None |
| A0A2H2JBQ5 | 8-248 | None |
| A0A836ARW6 | 42-279 | None |
| A0A0F8AEF5 | 129-300 | None |
| A0A183B834 | 43-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.