DPCstruct | MC28908
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 178 ± 15 aa |
| Standard deviation of domain lengths | 15.21 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 39.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C9SBY0 | 1-177 | MQQLLKLANEADIDALANVMEDFVEVFATELTPFAVALSEQLRDTYLRIVREVLDKNRNEGGDDDFGDYLDEKSITALGVLQTIGTL… |
| G1N3J0 | 366-539 | ISNQEKAKEYITPFIRPVMQALLHIIRETENDDLTNVIQKMICEYSEEVTPIAVEMTQHLAMTFNQVIQTGPDEEGSDDKAVTAMGI… |
| A0A453BSJ9 | 34-201 | None |
| A0A287I9T9 | 449-621 | None |
| A0A446MAZ1 | 343-546 | None |
| A0A3P7T4I1 | 2-199 | None |
| A0A3N6R390 | 2-154 | None |
| A0A5J5CFL9 | 526-700 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.