DPCstruct | MC28907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 108 ± 17 aa |
| Standard deviation of domain lengths | 17.23 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 40.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8A4P9 | 196-291 | TTGTTSVSPIKDALEVCSKEECDSIERYYQHHHFLFDKPSCVYKFQEGEADDRRRMYISFECSSENEKIAHRCANQDGHNDLNVMQN… |
| A0A1I8A3W1 | 2-99 | EIEVLQQGAVVNFVLQQCSKKEYNLFNAEYGYYRLIFFKPSCVHKYERGEGADLQKFHIAFDCAHGNQKGDLLRPASYNGHNELGLI… |
| A0A1I7YX65 | 57-166 | None |
| A0A1I7YXD6 | 25-122 | None |
| A0A1I7YHE3 | 161-246 | None |
| A0A1I8A5E7 | 26-153 | None |
| A0A1I8AIC0 | 384-497 | None |
| A0A1I7ZTM3 | 140-279 | None |
| A0A1I8AQQ6 | 1-83 | None |
| A0A1I8AQG6 | 13-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.