DPCstruct | MC28903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 182 ± 24 aa |
| Standard deviation of domain lengths | 24.23 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1KNU1 | 182-356 | QIDETKLELSTKALVSLLQARPPLLDMIPPMGYIKGLIDQLSNSKHSLVPHSALSVLHQLSYNKPCVESMIQYDYILSQMIKAISSD… |
| V9ICN7 | 62-237 | YKTAILILHQLAASEICISSICQTECISPLKHAMQSRRDMIAIACETLNRLFSTNEDRLIKQALDAEMVPYLLNILEGRLDIIENPA… |
| A0A6T8MWI6 | 2-206 | None |
| A0A7J9HMY0 | 31-229 | None |
| A0A6P8IXI7 | 299-502 | None |
| A0A7S2CGS2 | 202-397 | None |
| A0A2I0TJM6 | 640-850 | None |
| A0A818IKQ3 | 46-232 | None |
| A0A183VYN8 | 7-151 | None |
| A1Z7S0 | 2233-2404 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.