DPCstruct | MC28902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 538 |
|---|---|
| Mean domain length (aa) | 150 ± 26 aa |
| Standard deviation of domain lengths | 25.80 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 16.95 |
| Pfam Score | 95.89 |
| Assigned Pfam label(s) | CL0441- PF17057- PF03691 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9WM78 | 40-208 | IGELLGPDMESHFLEYKATLRTHADSGEVFRPLETASLKTIAAFFNSRTGGTLLMGVADDGTVAGLDSDYASLHKDGKDDRDLFQLH… |
| X5S7Q9 | 6-157 | QADEGQDLEYKSTLQFDLKEGTKSKFVRKATLKTIVAFLNSGSGSLVIGVSDDKKVVGLEHDLSTMSPERQSREWFQQTLVNLINEQ… |
| A0A2V7Y9D1 | 9-158 | None |
| A0A4R0KMT9 | 230-393 | None |
| A0A8B0DKD7 | 8-119 | None |
| R5N6B9 | 7-161 | None |
| A0A6L3EX38 | 298-449 | None |
| A0A1G1A419 | 14-105 | None |
| A0A7M5V351 | 12-164 | None |
| A0A6P8HWV7 | 10-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.