DPCstruct | MC2890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 229 ± 14 aa |
| Standard deviation of domain lengths | 14.29 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.22 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | PF19320- CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A174C350 | 747-962 | FENKYSSSMYYYIFRNRLIDNAVRGIEYSKEQFLADFREQYFREIFTLRYKNAQLLLNGVLDFLKGPEWLMEQDGEELNMSVMQAGY… |
| A0A251XDR2 | 1-242 | MSWVDKDDSQDWQAFFHARNRLIAALLHSPYERGGRFLTANLATDVRHLVSMQYFALAARHEAYRNILRGPRGLHEDMVTRLARTRE… |
| U0ER98 | 82-322 | None |
| A0A7J9VLN5 | 597-811 | None |
| G1UWI4 | 502-716 | None |
| A0A059Y222 | 400-626 | None |
| A0A1H6H8H9 | 360-584 | None |
| D4IY22 | 198-421 | None |
| A0A7X7V6D5 | 1-219 | None |
| A0A2N3GFE8 | 497-726 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.