DPCstruct | MC289
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 105 ± 10 aa |
| Standard deviation of domain lengths | 9.67 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0351 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0AG17 | 144-240 | LEQHLRHVEKDVLIPKIMREKARERCSEQVQEFTKCCKDSGVLMVVKCQKENSALKECLTAYYNDPAFYEECKMEYLKEREEFRKTG… |
| A0A0D6LHY3 | 5-106 | GDPDDRTLRRIEADVIIPNRMNARIEKVECHESYMGLINCMREKGAVKGLKLCKPELDVFNHCKFLKFNDTEFRERMTEEYLQERSE… |
| A0A6J2M484 | 4-100 | None |
| A0A6V7V1U7 | 51-171 | None |
| A0A833VTK3 | 78-187 | None |
| A0A670KAR6 | 47-153 | None |
| A0A6P8ZWY2 | 16-122 | None |
| A0A6P9A7H4 | 16-129 | None |
| A0A6J8B992 | 94-209 | None |
| A0A369S0E6 | 6-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.