DPCstruct | MC28898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 77 ± 9 aa |
| Standard deviation of domain lengths | 8.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0187 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F0LJQ3 | 102-175 | DAADRGPSDGATGTVNRDTAGNIVGYTAAPGDNTWSIGDRLCTNGLMLGRYNHVGTDPGDHALQPGETMVIRPD |
| A0A1I3CWJ5 | 1-92 | MIPNPEVPDLVPNAEPVPLPQGPAVDLGSTPGARGTTMSDGAGALLTYTVIEGDAFFDIAQRFNIPVQLLLTMNPSVPGLGENIYIK… |
| A0A0Q7W0B2 | 16-81 | None |
| A0A4R8WH78 | 156-233 | None |
| A0A2E9NDT4 | 32-100 | None |
| A0A2D9NW51 | 94-164 | None |
| A0A5F0GL98 | 119-216 | None |
| A0A4V5UC66 | 169-244 | None |
| A0A7S8RH95 | 64-142 | None |
| A0A0Q5FKY1 | 12-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.