DPCstruct | MC28895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 116 ± 9 aa |
| Standard deviation of domain lengths | 9.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9DAG0 | 47-167 | KWIEQIRKDLVISELGKTVANILGYIGYGIYNCPINYKKADWSNDTWIEIIWSRPLSNWDFDNLTRLILECHERLIRIDISGAAPNR… |
| A0A7Y5KXR3 | 4-116 | RPLTRDEAEDFFATFYRGKHHIPEKGVRDEGGGSWYVAHYNAGAGLSSFDYDDLTRLVFMAHDRGVRVSLHSSAPNYVKIRISHQRS… |
| A0A5R2ASP3 | 30-148 | None |
| A0A1D8A504 | 16-149 | None |
| A0A845XBP9 | 4-103 | None |
| A0A2D8J5J7 | 13-126 | None |
| A0A839DBU6 | 13-130 | None |
| A0A0F9MV10 | 16-123 | None |
| A0A7C1N4L6 | 1-104 | None |
| A0A1H2PQX0 | 97-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.