DPCstruct | MC28890
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 152 ± 21 aa |
| Standard deviation of domain lengths | 21.05 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16117 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A356TUV1 | 85-247 | AFVATAHATPSFGSHDVRTVFHIAKSDDRNRVDYGVHLNAQCQPVGEEPVYAYWHRFEPGHPRFGDLGFMDSRVYGITSQAVRTRSD… |
| A0A7Y5E2W7 | 1-131 | VVRVDETCAPVGNAPVRACWRDYERGKTATSPLLDHEQRAYGIARQRVVVRGPSGGEISMALRALPGRELTVRVRKDPAGACTALAY… |
| A0A6G0WZS3 | 178-340 | None |
| A0A7W1PX77 | 2-140 | None |
| A0A1F3SIC3 | 49-220 | None |
| A0A1V9YL93 | 443-609 | None |
| A0A7J6PN27 | 1020-1179 | None |
| A0A258W497 | 30-159 | None |
| A0A3N7HBK2 | 1-90 | None |
| A0A0S4JNM1 | 30-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.